Chromatography Supplies

Standards, connectors, fittings, tubing, tools, and other supplies for liquid chromatography (LC), ion chromatography (IC), and gas chromatography (GC).

New Lab Start-Up (27)
Offers (7)

special interests

Available on GSA/VA Contract (56)
Fast Shipping (51)
Greener Choice (4)
Production Products (65)
Science Education (1)
Small and Specialty Supplier (1,666)

Type

μ_Union (1)
1 Hour (1)
12 Hr/25°C (1)
120 V (1)
2-hole Ferrule (2)
2-way Connector (1)
220 V (1)

Show all

Material

100% Graphite (11)
15% Graphite, 85% Vespel (37)
316 Stainless Steel (Handle, Panel Nut, Bonnet Sleeve, Valve Stem, Bonnet, Body), PTFE (Lower Gland), Fluorine Rubber (O-Ring) (3)
40% Graphite, 60% Vespel (13)
Acrylic (1)
Aluminum (2)
Aluminum Oxide (1)

Show all

Diameter (Metric) Inner

0.050 mm (1)
0.051 mm (2)
0.053 cm (1)
0.063 in. (1)
0.075 mm (1)
0.076 mm (4)
0.1 cm (7)

Show all

Product Type

1078/1079 Split Liner with Frit (1)
ANX Sepharose 4 Fast Flow (2)
Blue Sepharose 6 Fast Flow Media (1)
Butyl Sepharose 4 Fast Flow Media (2)
Butyl Sepharose High Performance Media (1)
Butyl-S Sepharose 6 Fast Flow Media (1)
CM Sepharose Fast Flow Media (2)

Show all

Diameter (Metric) Outer

0.0317 cm (2)
0.15 cm (1)
0.158 cm (9)
0.2 cm (1)
0.275 cm (4)
0.3 cm (10)
0.317 cm (1)

Show all

Length (Metric)

< 8 cm Injector (1)
0.78 cm (1)
0.95 cm (2)
10 cm (1)
10.5 cm (23)
100 mm (7)
105 mm (44)

Show all

For Use With (Equipment)

0.020 in. Thru Hole (1)
0.050 in. Thru Hole; External Threads: 3/8-24 (1)
0.062 in. Compression Type Fitting, Fits Column 0.1, 0.15, 0.18, 0.25, 0.28 mm (4)
0.062 in. Compression Type Fitting, Fits Column I.D. 0.28, 0.32 mm (3)
0.062 in. Compression Type Fitting, Fits Column I.D. 0.45, 0.53 mm (3)
0.0625 in. Capillary Fitting (1)
0.0625 in. Compression Fitting Column 0.25 mm (1)

Show all

Liner Material

Borosilicate Glass (278)
Borosilicate Glass, CarboFrit (Closure Liner) (1)
Deactivated metal (3)
Glass (46)
Glass (Closure Liner) (1)
Graphite (5)
Highly Deactivated Borosilicate Glass (22)

Show all

Packing Material

10% OV-1 on Chromosorb W HP (2)
Base Deactivated (1)
Base Deactivated Wool (7)
CarboFrit (21)
Deactivated CarboFrit (1)
Deactivated Glass Wool (1)
Deactivated Wool (59)

Show all

Diameter (English) Inner

0.001 in. (3)
0.002 in. (5)
0.0025 in. (4)
0.003 in. (5)
0.004 in. (7)
0.005 in. (28)
0.006 in. (6)

Show all

Search Within Results

2,821 – 2,835 of 12,725 results

2,821

Medchemexpress LLC SjDX5-271 | 2767993-76-8 | 98.9% | 3336.52 | 1 MG

SjDX5-271 is a small 3 kDa peptide. It inhibits the TLR4/MyD88/NF-κB signaling pathway, induces cell polarization, alleviates hepatic inflammation, and protects mice against liver ischemia-reperfusion injury.

Inhibits TLR4/MyD88/NF-κB signaling pathway
Induces cell polarization
Alleviates hepatic inflammation
Protects mice against liver ischemia-reperfusion injury
Target: TLR4
Appearance: Solid, white to off-white
Sequence: YKNLGGQQQSGSSQGQFPSGQMQQQQRPQQ
Related classifications: Peptides, inflammation or immune system disease, blood or cardio-cerebrovascular disease, immunology/inflammation, NF-κB, Toll-like receptor (TLR)